PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g16490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NAC
Protein Properties Length: 415aa    MW: 46661.6 Da    PI: 8.78
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g16490genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.47.3e-50461721128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 + pGfrF Ptdeel+++yLkkkveg++  + evi+ev+i k+ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s +++
  CA11g16490  46 MFPGFRFCPTDEELISYYLKKKVEGSDKCV-EVISEVEIWKHEPWDLPaKSIVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS-GSN 142
                 579************************777.99***************777888999**************************************.99* PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +g+k+tLvf+ grapkg++t+W+mhey +
  CA11g16490 143 MIGTKRTLVFHIGRAPKGQRTQWIMHEYCM 172
                 ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5642189IPR003441NAC domain
PROSITE profilePS5100553.85946190IPR003441NAC domain
PfamPF023651.3E-2648171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MEDGDLLGST SEKKDGEIVK VYNNSGSNND GGEKNVGITV ATASSMFPGF RFCPTDEELI  60
SYYLKKKVEG SDKCVEVISE VEIWKHEPWD LPAKSIVQSD NEWFFFSPRG RKYPNGSQSK  120
RATESGYWKA TGKERNVKSG SNMIGTKRTL VFHIGRAPKG QRTQWIMHEY CMTGNSYYQD  180
SMVVCRLRKN NELPLNDTPG NQRNHLAATN VTTALFEAGQ LDGLGLINGG ECCSKEGSSS  240
YSSRSVEQIE SGSESDKLNK ELPQHHSSSY WKDRDEEDCF ADIMKDDIIK LDDSSDRARH  300
NLLPTITRKI EPSTKPTTSQ EAQNLMPQSH RLPFQGTANR RLKLQTEKPP RRVKRSEPHE  360
AIKKNSHARD ISRQLINIIP VTRTIPLLLV SLMLLIVYLS LFGVPKQVKS HYSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-454219116169NAC domain-containing protein 19
3swm_B4e-454219116169NAC domain-containing protein 19
3swm_C4e-454219116169NAC domain-containing protein 19
3swm_D4e-454219116169NAC domain-containing protein 19
3swp_A4e-454219116169NAC domain-containing protein 19
3swp_B4e-454219116169NAC domain-containing protein 19
3swp_C4e-454219116169NAC domain-containing protein 19
3swp_D4e-454219116169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755233e-99HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548085.10.0PREDICTED: NAC domain-containing protein 40-like
TrEMBLM1BQC90.0M1BQC9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000504820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.19e-78NAC domain containing protein 89